Hoe bestaat het (7-I)

hoe-bestaat-het8Het zevende hoofdstuk van ‘Hoe bestaat het’ heeft als titel: ‘Hoe zit het met overeenkomsten tussen organismen? En hoe zit het met andere argumenten die voor evolutie lijken te pleiten’. Na het theologische hoofdstuk 6 gaat dit dus meer de natuurwetenschappelijke kant op.

Wel begint het hoofdstuk met een theologisch statement. Na een korte uiteenzetting van wat er in de eerst twee hoofdstukken van Genesis staat, schrijven de auteurs naar aanleiding van Genesis 3:19 (gij zijt stof, en gij zult tot stof wederkeren):
“Sommigen zouden het verslag van de schepping van de mens in Genesis graag willen zien als een symbolische weergave van zaken, om het overeen te laten stemmen met de heersende zienswijze dat de mens uit de apen is geëvolueerd. Deze idee wordt hier in Genesis direct weerlegd: want als het stof waaruit adam gemaakt werd, gezien moet worden als de aap waaruit hij evolueerde, moet Adam weer in een aap zijn veranderd vanwege de zonde!”
Dit is een interessante, maar volledig foutieve redenering. Want wat hier eigenlijk staat is: als je Genesis niet letterlijk leest, gaat dat in tegen de letterlijke lezing van Genesis. En dat nog los van het feit, dat de evolutietheorie niet zegt dat de mens uit een aap is ontstaan, de mens evolueerde uit een hominide voorouder, en deelt een voorouder met de apen. Maar dat terzijde.

Toch wil ik even stilstaan bij de cirkelredenering die hierboven staat. Want deze wordt vaker gebruikt als het gaat om de manier waarop Genesis gelezen moet worden. Wanneer je uit gaat van evolutie, betekent de uitspraak dat de mens uit ‘stof’ voortkomt niet dat de mens letterlijk uit stof is gemaakt, maar dat we gemaakt zijn door God – uiteindelijk uit levenloze materie.

Mijn boek heet niet voor niets ‘Gevormd uit sterrenstof’. De mens is gevormd door God, via een proces dat begon met een oerknal, via sterren die de bouwstenen voor leven maakten en vervolgens evolutie. Wanneer dat samengevat is als ‘stof zijt gij en tot stof zult gij wederkeren’ is dat een prima beschrijving. Wie de opmerking letterlijk neemt, moet zich afvragen hoe dat dan met ons zit, als nakomelingen van Adam. Wij zijn uiteindelijk niet uit stof gemaakt, maar keren wel tot stof terug.

Het DNA van mens en chimpansee is 96 procent identiek, staat op blz. 135-138. Wat moeten we daarmee? De auteurs werken het verschil weg, door te stellen dat a) vergelijkbare wezens nu eenmaal een vergelijkbaar bouwplan hebben (een Porsche en Volkswagen Kever lijken ook op elkaar) en b) het verschil van 4 procent wel neerkomt op 120 miljoen basenparen, oftewel 40 dikke boeken vol informatie. Dat kan nooit door toevallige mutatie zijn ontstaan.

Eerst a) maar even. In mijn boek beschrijf ik dit argument ook. Daarbij voer ik aan, dat de overeenkomst niet alleen zit in de noodzakelijke ‘componenten’, maar ook in veel niet-noodzakelijke onderdelen. Oftewel: natuurlijk hebben mensen vergelijkbare genen voor vergelijkbare functies. Alleen, waarom liggen die dan ook vaak in een vergelijkbare volgorde op vergelijkbare chromosomen? En dan gaat het om een vaste volgorde van genen die niets met elkaar te maken hebben. Dus niet: alle oog-genen liggen bij elkaar (dat zou begrijpelijk zijn vanuit een ‘gemeenschappelijke ontwerper’. Maar het feit dat (ik noem even een fictief voorbeeld) er een gen voor oogkleur, voor teennagels en voor hersenverbindingen achter elkaar liggen bij zowel mens als aap. Waarom? We weten het niet. Goed, ten diepste is dat een ‘argument uit onwetendheid’, want er is een kans dat er wel degelijk een functionele noodzaak is voor die volgorde. Toch vind ik dat niet heel overtuigend.

Daarnaast geldt de overeenkomst ook voor niet-functionele delen van het DNA. Ook daar kan je weer zeggen, dat we de functie gewoonweg niet kennen. Inderdaad, de laatste jaren duiken er steeds meer functies op voor stukken die vroeger als ‘junk-DNA’ werden gezien. Maar de kans dat ze allemaal een nu nog onbekende functie hebben, is niet zo groot.

Bovendien gaat de vergelijking verder dan mens en aap. Ook met andere organismen delen we identieke stukken DNA. En het interessante is: de mate van overeenkomst komt goed overeen met de geschatte mate van evolutionaire verwantschap.

Dan argument b): het verschil is ook wel erg groot. Dat staat nog te bezien. Ten eerste: die 120 miljoen verschillen zitten voor een belangrijk deel in niet-coderend DNA. In coderend DNA (dus de genen) is de overeenkomst groter dan 96 procent. De opmerking dat een verschil van 120 miljoen (over het hele DNA) niet via toevallige mutaties (en natuurlijke selectie, maar dat noemen de auteurs niet) kan zijn ontstaan, wordt ook niet onderbouwd.

“Het is voor mutaties onmogelijk om de kloof tussen chimpansee en mens te overbruggen.” schrijven de auteurs wederom zonder onderbouwing op blz. 138. Dit is overigens ook een foute redenering, want evolutie hoefde de kloof tussen chimpansee en mens niet te overbruggen. Beide stammen af van een gemeenschappelijke voorouder. Beide hebben zich onafhankelijk – en in verschillende richtingen – ontwikkeld.

Vervolgens gaan de auteurs in op de ‘kwestie Haeckel’. De roemruchte tekeningen van Ernst Haeckel, die zouden laten zien dat de embryonale ontwikkeling een afspiegeling is van de evolutionaire afkomst. De mens stamt af van een vis, dus het menselijke embryo gaat door een ‘vissenstadium’ met kieuwspleten. Hier is al ontzettend veel over gezegd. Een uitgebreid artikel staat hier.

Al vanaf 1894 zijn de ideeën van Haeckel kritisch besproken door andere wetenschappers. Een probleem is wel, dat de tekeningen een eigen leven zijn gaan leiden in schoolboeken. Daar schijnen ze nog steeds te worden gebruikt, wat inderdaad niet goed is. Maar de theorie van Haeckel maakt al heel, heel lang geen deel meer uit van het denken over evolutie. Dit is al vele malen herhaald. Iedere professionele (evolutie)bioloog weet dat Haeckel er naast zat. Waarom wordt dit dan toch weer opgevoerd als een bewijs tegen evolutie? Geen idee. Het maakt in ieder geval dat ik een flink aantal bladzijden kan overslaan.

Vanaf blz 143 gaan de auteurs verder in op verschillen en overeenkomsten tussen embryo’s van verschillende soorten. Ze halen de ‘wet van Von Baer’ aan, die stelt dat embryo’s meer op elkaar lijken naar mate ze ‘jonger’ zijn, want ze ontwikkelen zich steeds verder op een min of meer gelijke basis. Maar, alle embryo’s gaan vervolgens door een faryngula-stadium, waarin ze weer heel sterk op elkaar lijken. Kortom: eerst overeenkomst, dan verschil, dan weer overeenkomst en dan weer verschil. Dat kan toch helemaal niet?

“God maakte de dingen met bepaalde overeenkomsten om te tonen dat er één Schepper is, zoals de overeenkomsten in het faryngula-stadium laten zien, maar met een zodanig patroon dat deze overeenkomsten niet het resultaat kunnen zijn van gemeenschappelijke voorouders (evolutie), omdat de vroege stadia van ontwikkeling van de embryo’s sterk verschillen.” Dit staat op blz. 144.

Een probleem met deze uitspraak is, dat nergens (ook niet elders in het hoofdstuk) is aangegeven hoe groot de verschillen en overeenkomsten zijn. En bij de uitspraak dat evolutie ze niet kan verklaren, staat ook niet wat ontwikkelingsbiologen hier van zeggen.

Bovendien, op de overeenkomst in het faryngula-stadium is nog wel wat af te dingen. Er zijn in dit stadium ook forse verschillen, zo blijkt uit werk van W.W. Ballard. De auteurs moeten hier vanaf weten, ze halen een publicatie van hem aan in een voetnoot.

Ballard schrijft: “Some of these actual pharyngulas have a tailfin and some do not. Those which are tetrapods have lung buds, the fish pharyngulas lack them. They all have a liver, to mention an organ at random, but the livers of fishes, birds and mammals are interestingly different in detail even at the pharyngula stage. Arteries can be compared easily but there is little uniformity in the veins. Most conspicuously, the circumstances and needs for respiration, nutrition, and excretion at this stage have been met by a good many structures of a temporary nature, aptly referred to as scaffolding tissues, which are in bold contrast in the different classes of vertebrates.”

Als uitsmijter wordt nog iets gezegd over een professor Gavin de Beer, die het probleem bespreekt “van het ontbreken van een genetische of embryologische basis voor homologie”. En dat al meer dan dertig jaar geleden, melden de auteurs triomfantelijk. Tjsa. Hij schreef het in 1971, ver voordat het mogelijk was om gedetailleerd genetisch onderzoek te doen. Het zou overtuigender zijn, wanneer de auteurs hier een recente ontwikkelingsbioloog hadden aangehaald. Opnieuw dus een weinig overtuigende redenering (zie ook deze opmerking).

Dit is al een aardige lap tekst geworden, dus ik zal de rest van dit hoofdstuk een volgende keer bespreken.

Please follow and like:

203 gedachten over “Hoe bestaat het (7-I)”

  1. Ik denk dat het probleem is, om vrank en eerlijk te zijn, dat arnoud vaak ingaat op halve zinnen, en die gaat overanalyseren. Het is niet leuk schrijven als je bij elk woord dat je schrijft moet denken – oei – zou dat eventueel verkeerd te begrijpen zijn.

    Ik heb verder nog een kleine vraag/opmerking aan René. Je zegt dat de ‘omgeving niet deel is van evolutie’. Wij mensen zijn echter wel een product van evolutie, en alles wat wij veranderen aan de omgeving is dus ook een product van evolutie. Of maak ik een denkfout?

  2. @René,
    We waren volgens mij al een eind op weg. Ik heb je eerdere posts nog eens gelezen en kwam met het bottle neck zinnetje.

    Voor mij was het inmiddels niet luchtig meer. En ik vind het inmiddels ook wel een belangrijk punt worden. Maar goed, zoals gezegd, het staat je vrij om te reageren.

    Ik heb je al eerder gezegd dat ik al niet begrijp hoe je het voor elkaar krijgt deze blog bij te houden. Ik hoef niet daarvoor niet te weten wat je programma is.

    Wat ik wel zie is dat je uitputtend op Albert ingaat, maar bij mij stop je de discussie, omdat je nog van alles te doen hebt. Dat is al eens eerder gebeurd en de reden die je toen opgaf was, dat ik niet in een hokje paste. Ik voel me hierdoor niet erg serieus genomen.

    Succes met het voorbereiden van je lezing en het houden ervan.

    Goede Feestdagen!

    arnoud

  3. @Jona,

    “Ik denk dat het probleem is, om vrank en eerlijk te zijn, dat arnoud vaak ingaat op halve zinnen, en die gaat overanalyseren. Het is niet leuk schrijven als je bij elk woord dat je schrijft moet denken – oei – zou dat eventueel verkeerd te begrijpen zijn.”

    Ik analyseer redeneringen, nooit halve zinnen. Soms haal ik ze inderdaad te veel uit de context. Dat geef ik later dan ook toe. Als ik zelf redeneer, probeer ik inderdaad te voorkomen dat ik iets schrijf wat verkeerd wordt opgevat. Als iemand het verkeerd opvat, probeer ik er vanuit te gaan dat IK het niet duidelijk heb uitgelegd. Ik vind het zwak om te zeggen, dat de ander dan je redenatie niet al te serieus moet nemen. Dit medium is (zoals René vaak aangeeft) al vaak genoeg aanleiding tot misverstanden, dus nauwkeurig formuleren lijkt me geen overbodige luxe.

    “Ik heb verder nog een kleine vraag/opmerking aan René. Je zegt dat de ‘omgeving niet deel is van evolutie’. Wij mensen zijn echter wel een product van evolutie, en alles wat wij veranderen aan de omgeving is dus ook een product van evolutie. Of maak ik een denkfout?”

    Het feit dat je dit vraagt is al reden genoeg om elkaar te bevragen op wat je nu precies bedoelt. Ik begrijp René ook niet helemaal en daarom ‘overanalyseer’ ik. Jouw vraag is ook mijn vraag. Misschien maak ik ook denkfouten. Ik ben alleen door René’s antwoorden nog niet echt verder gekomen.

  4. Nog ééntje dan (even los van het feit dat drukte relatief is, dus soms heb ik meer mogelijkheid om lang door te gaan dan op andere tijden – zoals net voor Kerst).
    @ jona: De mens is product van evolutie. Maar de evolutie van trekvogels is niet gerelateerd aan / afgestemd op de evolutie van de mens. Alleen als de mens iets doet dat direct raakt aan vogels, kan dat effect hebben.

    Maar je kunt de klimaatverandering niet een ‘product van evolutie’ noemen. De door mensen gedreven klimaatsverandering is (vanuit het perspectief van de evolutie) niet ‘natuurlijker’ of ‘onnatuurlijker’ dan de laatste ijstijd. Klimaatsverandering is klimaatsverandering.

    En nu weer terug naar de lezing, voor de conferentie ‘Expeditie Ninevé’, dus over: Jona (nou ja, daar begin ik mee, alvorens het mij opgegeven onderwerp van geloof en wetenschap aan te pakken).

  5. @Albert:

    Over groepen en microevolutie:

    1:
    @Albert 17 dec 7.57 pm
    Er is wel zeker een breuk in het ‘patroon’.
    Ik heb op 17 dec 8.40 pm gevraagd waar er een breuk zit in het patroon. Waar en op welke criteria zie je ‘breuken’?

    2:
    @Albert 18 dec 4.36 pm
    Tevens hoeft niet iedere soort een nieuwe schepping te zijn. Veel soorten kunnen via ‘micro-evolutie’ ontstaan zijn uit andere.

    Albert’s probleem is dat hij nu moet vertellen welke soorten door microevolutie ontstaan zijn, en welke geschapen. Bovendien op een dergelijke manier dat het waargenomen patroon in de beesten etc te voorschijn komt.

  6. Beste, ik kon een tijdje niet op de site komen. Was hij uit de lucht of was er iets met mijn pc?

    Ik hoop z.s.m. te reageren.

  7. Ik ben een tijdje niet in de gelegenheid geweest te reageren. Toch wil ik de vraag die er nog ligt, beantwoorden.

    @ Gerdien:

    @Albert 17 dec 7.57 pm
    Er is wel zeker een breuk in het ‘patroon’.
    Ik heb op 17 dec 8.40 pm gevraagd waar er een breuk zit in het patroon. Waar en op welke criteria zie je ‘breuken’?

    Voordat ik stelde dat er wel een breuk in het patroon zit, zei ik dat je niet op mijn vragen inging, maar dat je wel telkens van mij vraagt om op jouw vragen in te gaan. Ik heb jou veel vragen gesteld, waar je niet op in bent gegaan. Daarom vraag ik je in het vervolg ook eens een vraag van mij mee te nemen.

    Ik vind het te vaag om over een patroon te spreken. Door te zeggen dat er een breuk in het patroon zit, heb ik mezelf al een bepaalde richting in geduwd.

    Er is overeenkomst in DNA sequenties. Jij ziet een patroon. Je bedoelt dat je overeenkomst ziet in het hemoglobine gen van de mens en van een hoog zoogdier. Die overeenkomst noem jij een patroon. Daarmee lijk je een verbinding te leggen tussen beide sequenties. Die connotatie had ik in eerste instantie niet bij ‘patroon’. De breuk is het volgende: zolang je niet kan aantonen hoe het van Gen A tot Gen B gekomen is, is er een breuk in het patroon. De connotatie ‘verwantschap’ valt dan weg en je houdt ‘overeenkomst’ over. Dat is de door mij bedoelde ‘breuk in het patroon’.

    @Albert 18 dec 4.36 pm
    Tevens hoeft niet iedere soort een nieuwe schepping te zijn. Veel soorten kunnen via ‘micro-evolutie’ ontstaan zijn uit andere.

    Albert’s probleem is dat hij nu moet vertellen welke soorten door microevolutie ontstaan zijn, en welke geschapen. Bovendien op een dergelijke manier dat het waargenomen patroon in de beesten etc te voorschijn komt.

    @ Gerdien: Dat kan ik niet. Het is ook een veronderstelling gebaseerd op het feit dat alle soorten varianten zijn. Immers hierboven heb ik aangehaald dat er nog geen mogelijke verklaring is gegeven voor hoe Gen A evolueert tot Gen B. Wel in algemene lijnen a.h.v. genduplicatie en gendifferentiatie, maar niet ondersteund a.h.v. experimenten.

    Vraag: Aangezien de biologie niet kan aantonen dat er ‘macro-evolutie’ heeft plaatsgevonden en jij voor dat gegeven verwijst naar de geologisch kolom, kan ik dan zeggen dat de biologie geen antwoord geeft op de vraag waarvan iedereen denkt dat het antwoord erop bij de biologie te vinden is?

    Tevens, je verwees naar de geologische kolom. Daarmee verwijs je naar een ander vakgebied voor je ‘bewijs’ voor evolutie. Hoeveel kennis heb jij van geologie?

    @Rene: Jij vroeg me naar de bron voor mijn uitspraak dat de gegevens die Setterfield gebruikt voor de ontwikkeling van de lichtsnelheid gemeten zijn met dezelfde apparatuur. Heb je daar nog belang bij, want dan zoek ik die nog even op.

  8. Wel in algemene lijnen a.h.v. genduplicatie en gendifferentiatie, maar niet ondersteund a.h.v. experimenten.

    Moet zijn:

    Wel in algemene lijnen a.h.v. genduplicatie en gendifferentiatie, maar niet concreet ondersteund a.h.v. experimenten.

  9. @albert

    Volgens Setterfield is er sprake van c-decay, dat betekend dat alles wat wij in het heelal zien in werkelijkheid veel sneller verliep. Dat betekend dat binaire sterren in werkelijkheid een grotere periodetijd hebben dan wij waarnemen. Omdat volgens Setterfield de wetten van Kepler gewoon geldig blijven moet de massa van de binaire sterren veel groter zijn. Voor een binair ster systeem in Andromeda zou dat betekenen dat de massa een factor 90000 groter moeten zijn, maar zulke sterren kunnen niet bestaan. Door de zwaartekracht zullen deze samentrekken tot een zwart gat. Hoe leg jij dit dan uit Albert?
    Bron: http://homepage.mac.com/cygnusx1/cdecay/cdecay_2007Jellison.pdf (pagina 25)

    http://homepage.mac.com/cygnusx1/cdecay/cdecay_2007Jellison.pdf

  10. Albert,

    Als je pagina 25 van de genoemde bron leest, kijk dan ook gelijk een paar pagina’s verder. Een consequentie van Setterfields theorie is dat de atmosfeer van de Aarde een paar 1000 jaar geleden is weggelekt…

  11. Ik ben geen kenner van Setterfields theorie. Ik ben ook geen natuurkundige. Ik heb hem persoonlijk gesproken en vond het een interessante theorie. Vooral omdat ik zelf sceptisch was. Ik heb tegen hem gezegd dat hij een interessant verhaal heeft, maar dat ik hem voor de meter niet vertrouw 😉
    Een van de argumenten die altijd aangedragen wordt is dat de nieuwe apparatuur preciezer is en dat daarmee de afnemende lichtsnelheid is verklaard. Dit is onjuist. Al zijn gegevens die hij gebruikt om aan te tonen dat de lichtsnelheid afneemt, zijn verkregen met dezelfde apparatuur.

    Wat betreft Jellison, ik heb de tijd niet om dat nu uit te zoeken. Setterfield heeft bepaalde kritiek van Jellison wel verwerkt in zijn nieuwe papers:
    Bron: http://www.setterfield.org/Jellison.html

    Het enige wat ik er over kan zeggen is dat de m in E=mc2, een andere is dan de massa van een object. Maar goed, daar kan ik naast zitten.

  12. Albert, Setterfield beroept zich op metingen uit de 17e,18e,19e en begin 20e eeuw. Allemaal afzonderlijk door wetenschappers met elk hun eigen materiaal gedaan.

  13. @Albert
    Kennelijk tellen observaties niet mee … en daarmee een bijzonder groot deel van de biologie.
    Wat wil Albert hebben: genetische variatie binnen populaties in een gen? Genduplicatie binnen populaties? Verschillen en overeenkomsten in gensequenties?

    Wat is een concreet experiment voor Albert? Als een concreet experiment zou zijn: een experiment dat gericht een mutatie in een gen stopt dan: zo werkt biologie niet. Biologie gaat uit van wat er is.

    zolang je niet kan aantonen hoe het van Gen A tot Gen B gekomen is, is er een breuk in het patroon.
    Nu weet ik niet of gen A en gen B gen X in soort A en soort B betekent of gen A en gen B binnen soort X.
    Maar, in beide gevallen: zou een lijst van opeenvolgende mutaties die van A naar B gaan voldoen?

  14. @Albert
    Aangezien de biologie niet kan aantonen dat er ‘macro-evolutie’ heeft plaatsgevonden
    Ik heb her en der in dit blog gezegd dat macro-evolutie een naam is voor een patroon, en geen apart proces. Er hoeft geen ‘macro-evolutie’ aangetoond te worden, als je bedoelt dat er een proces ‘macro-evolutie’ zou bestaan. Zo’n proces bestaat niet. Als je weigert de sortering van de beesten in een patroon te aanvaarden, is er uiteraard geen macro-evolutie – per definitie niet, omdat je ordening die aanwezig is in de beesten niet erkent.
    Het probleem hier is niet de biologie, maar een a priori idee van hoe aantonen werkt.

  15. @Albert
    Dit is het soort gegevens:
    Gamma hemoglobine: gedupliceerd gen in mensapen
    Hier staat 1/3 van de aminozuurvolgorde
    * betekent alle aminozuren gelijk in alle soorten.

    gamma_1_Homo_sapiens PENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH 147
    gamma_1_Pan_troglodytes PENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH 147
    gamma_1_Gorilla_gorilla PENFRLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH 147
    gamma_1_Pan_paniscus PENFRLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH 147
    gamma_2_Pan_troglodytes PENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH 147
    gamma_2_Gorilla_gorilla PENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH 147
    gamma_2_Homo_sapiens PENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH 147
    gamma_Macaca_mulatta PENFRLLGNVLVTVLAIHFGKEFTPEVQASWQKMVAGVASALSSRYH 147
    gamma_Macaca_fuscata PENFRLLGNVLVTVLAIHFGKEFTPEVQASWQKMVAGVASALSSRYH 147
    gamma_Papio_cynocephalus PENFRLLGNVLVTVLAIHFGKEFTPEVQASWQKMVAGVASALSSRYH 147
    ****:******************************:.**********

    Elders meer, want ik kan hier geen plaatjes geven.

  16. Albert schreef: “Dat roepen iedereen die kritiek heeft. Al zou het zo zijn; dan zou je een variatie naar boven en naar beneden moet hebben. Het opvallende is dat de ‘variatie’ voornamelijk lagere snelheden geeft. Ik raad je aan deze paper eens te lezen: http://www.setterfield.org/report/report.html163
    Van jouw link; “measurements of c in dynamical time by 16 methods over 300 years.”

    16 methoden dus Albert, niet zoals jij stelde dezelfde apparatuur, daar ging het mij even om.

    Van Talk Origins:
    Setterfield chose 120 data points from 193 measurements available (see Dolphin n.d. for the data), and the line of best fit for these points shows the speed of light decreasing. If you use the entire data set, though, the line of best fit shows the speed increasing. However, a constant speed of light is well within the experimental error of the data.

  17. http://www.talkorigins.org/faqs/c-decay.html

    Zie het artikel van Goldstein et al. dat daar gelinkt wordt, en “After considerable mathematical analysis, the three authors conclude, “… we estimate that the difference between light travel time three hundred years ago and today’s value is less than 0.5%” (emphasis added). In fact, the authors plot a set of residuals against light travel time and state, “The best fit occurs at zero where the light travel time is identical to the currently accepted value value,” completely contradicting the value in Setterfield’s table.”

  18. @ Vince:

    Niet zo snel. Als je even verder gelezen had:

    ‘All 16 methods of c measurement give a decay both individually and collectively.’

  19. @ Gerdien,

    Ik zie overeenkomst en verschil. Kan de generatietijd er mee te maken hebben?

    @ Gerdien: ‘Als je weigert de sortering van de beesten in een patroon te aanvaarden, is er uiteraard geen macro-evolutie – per definitie niet, omdat je ordening die aanwezig is in de beesten niet erkent. Het probleem hier is niet de biologie, maar een a priori idee van hoe aantonen werkt.’

    Er is overeenkomst en jij ziet aanleiding om te denken dat dat het gevolg is van common ancestry. Dan wil ik wel eens weten wat jouw a priori van aantonen is. Jij kunt je voor jouw idee enkel en alleen beroepen op de overeenkomsten en de geologische kolom (waar je waarschijnlijk geen kennis van hebt en waar je wel degelijk naar hebt verwezen als argument voor ‘macro-evolutie’). Jij kunt niet aantonen dat het genetisch materiaal verdubbelt, differentieert en functioneel wordt. Toch beweer je dat dit is gebeurd. Dus maak het dan ook maar hard.

    We komen zo geen steek verder. Ik denk niet dat je onzin verkondigt. Zo wil ik in ieder geval niet overkomen, maar we hebben beide een andere bril op.

    p.s. er liggen ook nog twee vragen uit mijn vorige reactie op jou. Wees eens eerlijk….

  20. @albert

    Een verandering van 0.5% in de lichtsnelheid is niet zo relevant. Wil Setterfield gelijk hebben dan moet de lichtsnelheid in het verleden veel groter zijn dan nu. Het probleem van Setterfields theorie is dat waarnemingen in het heelal dat uitsluiten. Denk dan aan binaire sterren, pulsar en supernova’s. Als op zeg, 200.000 lichtjaar een ster ontploft en wij een jaar later reflecties van die supernova zien op stofwolken die een lichtjaar van de exploderende ster verwijdert zijn. Lijkt mij het aannemelijk dat de lichtsnelheid min of meer constant gebleven is.

    Ik heb je link nagelezen, maar zag er geen argumenten in tegen de argumenten die ik hierboven aandroeg.

    Wat je met je opmerking over E=mc^2 bedoeld begrijp ik niet. De m in de vergelijking is de rustmassa van een object.

    Ook het idee dat de roodverschuiving gekwantiseerd is geloof ik niet: http://en.wikipedia.org/wiki/File:2dfgrs.png
    (hierbij is bij 220000 sterrenstelsels de roodverschuiving gemeten, waaruit de afstand berekend is)

  21. @ Gerdien
    “Elders meer, want ik kan hier geen plaatjes geven.”

    Waar, op u blog? Iets meer toelichting zou ik namelijk wel prettig vinden, ik ben namelijk geen bioloog.

  22. Albert, nog een laatste keer dan, jij schreef:
    “@Rene: Jij vroeg me naar de bron voor mijn uitspraak dat de gegevens die Setterfield gebruikt voor de ontwikkeling van de lichtsnelheid gemeten zijn met dezelfde apparatuur. Heb je daar nog belang bij, want dan zoek ik die nog even op.”

    Ik gaf je 16 verschillende methoden met 16 verschillende apparaten en 16 verschillende mensen op 16 verschillende tijden.

    Als je me nu weer moedwillig verkeerd begrijpt weet ik genoeg.

  23. @GW: er is geen verandering van 0.5%. Zie het genoemde artikel van Goldstein et al: “less than 0.5%” en de beste fit is bij 0%. Daarmee is de discussie beeindigd.

    Overigens, in E=Mc^2 is m niet de rustmassa. m is de rustmassa gedeeld door de wortel uit (1-(v/c)^2). Als je bij v/c<<1 een reeksexpansie maakt dan krijg je E=m0c^2 + (1/2)m0v^2, waarbij m0 de rustmassa is en de tweede term de gebruikelijke kinetische energie.

  24. @ allen: Een kleine waarschuwing tussendoor, laten we er in de hier lopende discussies vanuit gaan dat deelnemers eerlijk zijn in wat ze melden. Ik snap dat sommige discussies wat kribbigheid kunnen veroorzaken, omdat het lijkt alsof mensen koppig of onwillig zijn om argumenten aan te nemen dan wel vragen te beantwoorden.

    In mijn ervaring is er zelden tot nooit sprake van kwade wil/kwade opzet, meestal gaat het om zeer vaste overtuigingen (die nu eenmaal niet snel gaan wankelen) of een gebrek aan overzicht in het verloop van de discussie (wat vrij gemakkelijk gebeurt wanneer zoals hier verschillende debatten door elkaar lopen). Of simpelweg begripsverwarring.

    Zoals wij vroeger bij SSR-NU zeiden: Politesse! (en lees de boel nog even door op al te stekelige opmerkingen voordat je op ‘Reageer’ drukt).

  25. @GW
    Komt op mijn blog, maar data natrekken, plaatjes maken en blog schrijven kost wat tijd.

    @Albert
    Jij kunt niet aantonen dat het genetisch materiaal verdubbelt, differentieert en functioneel wordt
    In Drosophila melanogaster zijn er populaties waarin elke vlieg 1 gen voor amylase heeft, en er zijn populaties waarin elke vlieg twee genen voor amylase heeft, en er zijn populaties waarin sommige vliegen 1 gen hebben en andere vliegen 2 genen hebben. De twee genen voor amylase liggen een duizendste recombinatieprocent uit elkaar, en komen sterk overeen: onder andere in genetische variatie. In beesten met twee genen (die in dit geval te herkennen zijn aan genetische variatie die leidt tot verschil loopsnelheid in een electrisch veld), is ooit (1966 of zo) gekeken naar de enzymactiviteit in larven en volwassenen. Het ene gen is meer actief in larven, en het andere gen is meer actief in volwassenen.
    Daarmee hebben we hier: een genduplicatie in een huidige populatie, met een zekere differentiatie in functie.

  26. @Albert
    Overeenkomst in beesten is waarneembaar het gevolg van 1) verwantschap en 2) dezelfde oecologie.
    Denk je dat er nog meer waarneembare oorzaken van overeenkomst zijn?

  27. @ Vince: je hebt mijn reactie op jou niet gelezen. Het lijkt er eerder op dat jij moedwillig mij niet wil begrijpen.

    @ Gerdien: ik trek het even na. Ik kan er zo een twee drie niet diep op reageren. Wat er zo bij me opkomt is of er wel sprake is van een nieuwe functie. Het feit dat het ene gen meer bij larven tot expressie komt dan het andere kan te maken hebben met dat larven ander voedsel consumeren dan de vliegen. De samenstelling van het voedsel heeft immers invloed op de expressie van de genen. Dit komt geloof ik ook bij mensen voor. Mijn reactie komt dus nog.

  28. p.s. Gerdien, voor de zoveelste keer; reageer ook eens op mijn vragen. Ik probeer ook zo beleefd te zijn om op jouw vragen te reageren.

  29. @Albert
    Gerdien: overeenkomst kan zijn:
    a. verwantschap
    b. common creator

    Ik vroeg naar een waarneembare oorzaak van overeenkomst. Een creator is een veronderstelde oorzaak van overeenkomst (ooit in een niet waargenomen verleden), en niet een nu waarneembare oorzasak van overeenkomst.

  30. @Albert
    Wat vraag je eigenlijk waarop ik niet antwoord.

    Vliegen en larven krijgen hetzelfde voedsel (lab). Andere expressie in larven (hoe dan ook veroorzaakt) is een andere functie. Een iets meer larvaal actief en een iets meer adult actief gen.
    Amy-expressieverschil staat dacht ik in:
    W.W. Doane, 1969. Drosophila amylases and problems in cellular differentiation. In: “RNA in Development”, edited by R. W. Hanly

    Vergeet de oecologie als bron van overeenkomst niet.

  31. albert
    januari 6th, 2010 on 8:50 pm
    @ Gerdien,
    Ik zie overeenkomst en verschil. Kan de generatietijd er mee te maken hebben?

    Dit gaat over de aminozuurvolgorde van gamma hemoglobine. De mensapen verschillen weinig onderling en de drie makaken verschillen niet in aminozuur volgorde. De mensapen verschillen onderling in generatietijd, niet alleen de mensapen met de makaken. Zodat verschil in generatietijd als verklaring van het verschil in aminozuurvolgorde niet voor de hand ligt.

  32. @Albert
    nergens in deze serie van comments heb ik naar geologie verwezen: ik heb ze nog eens doorgekeken. Verder in vorige comments denk ik ook niet, omdat ik me richt op moleculaire verschillen en overeenkomsten.
    Macroevolutie volgt wat mij betreft uit moleculaire overeenkomst. Macroevolutie is geen proces, en kan niet als proces onafhankelijk van de processen selectie en soortvorming bestudeerd worden.

  33. Nog iets over de amylase genduplicatie in Drosophila melanogaster.
    A. J. Klarenberg, A. J. S. Visser, M. F. M. Willemse, and W. Scharloo, 1986. Genetics, 114: 1131 – 1145
    Figuur 2 en figuur 6 geven verschil in genexpressie van de twee genen van de amylase genduplicatie in één beest. Dat is functieverschil tussen de genen van de duplicatie.

  34. @Albert , januari 5th, 2010 on 6:38 pm
    Immers hierboven heb ik aangehaald dat er nog geen mogelijke verklaring is gegeven voor hoe Gen A evolueert tot Gen B.
    Dit is zo weinig specifiek dat het onduidelijkis wat gevraagd wordt.
    Misschien helpt dit lange citaat:

    Nature 461, 515-519 (24 September 2009)
    An epistatic ratchet constrains the direction of glucocorticoid receptor evolution
    J.T. Bridgham, E.A. Ortlund & J.W. Thornton

    Abstract: The extent to which evolution is reversible has long fascinated biologists(1-8). Most previous work on the reversibility of morphological and life-history evolution(9-13) has been indecisive, because of uncertainty and bias in the methods used to infer ancestral states for such characters(14,15). Further, despite theoretical work on the factors that could contribute to irreversibility(1,8,16), there is little empirical evidence on its causes, because sufficient understanding of the mechanistic basis for the evolution of new or ancestral phenotypes is seldom available(3,8,17). By studying the reversibility of evolutionary changes in protein structure and function, these limitations can be overcome. Here we show, using the evolution of hormone specificity in the vertebrate glucocorticoid receptor as a case-study, that the evolutionary path by which this protein acquired its new function soon became inaccessible to reverse exploration. Using ancestral gene reconstruction, protein engineering and X-ray crystallography, we demonstrate that five subsequent ‘restrictive’ mutations, which optimized the new specificity of the glucocorticoid receptor, also destabilized elements of the protein structure that were required to support the ancestral conformation. Unless these ratchet-like epistatic substitutions are restored to their ancestral states, reversing the key function-switching mutations yields a non-functional protein. Reversing the restrictive substitutions first, however, does nothing to enhance the ancestral function. Our findings indicate that even if selection for the ancestral function were imposed, direct reversal would be extremely unlikely, suggesting an important role for historical contingency in protein evolution.

    http://www.nytimes.com/2009/09/29/science/29evol.html?_r=1
    http://blogs.discovermagazine.com/loom/2009/10/15/the-blind-locksmith-continued-an-update-from-joe-thornton/

    @Albert , januari 5th, 2010 on 6:38 pm
    Vraag: Aangezien de biologie niet kan aantonen dat er ‘macro-evolutie’ heeft plaatsgevonden en jij voor dat gegeven verwijst naar de geologisch kolom, kan ik dan zeggen dat de biologie geen antwoord geeft op de vraag waarvan iedereen denkt dat het antwoord erop bij de biologie te vinden is?
    a) Ik verwijs nooit naar de geologische kolom. b) macro-evolutie is een patroon, geen proces; de waargenomen ‘grote’ verschillen worden geacht het gevolg te zijn van soortvorming en tijd, net als bij een boom de waargenomen ‘grote’ verschillen tussen dikke takken het gevolg zijn van knopvorming en tijd; c) je kunt dus niet zeggeen dat de biologie geen antwoord geeft; d) het begin probleem ligt bij het woord ‘aantonen’ in Aangezien de biologie niet kan aantonen dat er ‘macro-evolutie’ heeft plaatsgevonden, want er wat de biologie zegt wordt niet aanvaard als ‘aantonen’.

  35. Sorry Albert, we zijn als gesprekspartner
    niet compatible, ik hou ermee op.

    Sorry Rene voor mijn kribbige reactie.

  36. albert
    januari 6th, 2010 on 8:50 pm
    @ Gerdien,
    Ik zie overeenkomst en verschil. Kan de generatietijd er mee te maken hebben?
    Dit gaat over de aminozuurvolgorde van gamma hemoglobine. De mensapen verschillen weinig onderling en de drie makaken verschillen niet in aminozuur volgorde. De mensapen verschillen onderling in generatietijd, niet alleen de mensapen met de makaken. Zodat verschil in generatietijd als verklaring van het verschil in aminozuurvolgorde niet voor de hand ligt.

    De sequenties komen op een paar verschillen na, goed overeen. Voor mij betekent dat, dat de selectiedruk hoog is.
    Organismen met een lagere generatietijd lopen meer mutaties op. Dit laatste argument gaat inderdaad voor de primaten onderling niet op en dus zijn de verschillen mijns of functioneel, of het gevolg van al dan niet random mutaties. Het voorbeeld is absoluut niet dwingend voor common descent.

    Gerdien
    januari 7th, 2010 on 1:18 pm
    @Albert
    Wat vraag je eigenlijk waarop ik niet antwoord.

    Vliegen en larven krijgen hetzelfde voedsel (lab). Andere expressie in larven (hoe dan ook veroorzaakt) is een andere functie. Een iets meer larvaal actief en een iets meer adult actief gen.
    Amy-expressieverschil staat dacht ik in:
    W.W. Doane, 1969. Drosophila amylases and problems in cellular differentiation. In: “RNA in Development”, edited by R. W. Hanly

    Vergeet de oecologie als bron van overeenkomst niet.

    Ik kan zo snel geen theorie vinden die beschrijft wat hier precies aan de hand is. Wel ellenlange stukken over dit onderzoek waar jij ook aan mee gewerkt hebt. Ik blijf het betwijfelen of er hier sprake is van een nieuwe functie. Ik had eigenlijk gehoopt op een sterker voorbeeld. Tevens, hoewel ik het theoretisch voor mogelijk houdt,kan ik er niet achter komen hoe zeker het is dat hier sprake is van een duplicatie.

    Gerdien
    januari 7th, 2010 on 1:09 pm
    @Albert
    Gerdien: overeenkomst kan zijn:
    a. verwantschap
    b. common creator

    Ik vroeg naar een waarneembare oorzaak van overeenkomst. Een creator is een veronderstelde oorzaak van overeenkomst (ooit in een niet waargenomen verleden), en niet een nu waarneembare oorzasak van overeenkomst.

    Hoezo? Is de oorzaak van overeenkomst (verwantschap) die jij aandraagt een waarneembare? Het is afgeleid uit de theorie. Een interpretatie gevoed door je paradigma. Een Creator is inderdaad een veronderstelde oorzaak van overeenkomst. Net zoals jouw hypothetische gemeenschappelijke voorouder een veronderstelde oorzaak van overeenkomst is.

    Gerdien
    januari 7th, 2010 on 2:06 pm
    @Albert
    nergens in deze serie van comments heb ik naar geologie verwezen: ik heb ze nog eens doorgekeken. Verder in vorige comments denk ik ook niet, omdat ik me richt op moleculaire verschillen en overeenkomsten.
    Macroevolutie volgt wat mij betreft uit moleculaire overeenkomst. Macroevolutie is geen proces, en kan niet als proces onafhankelijk van de processen selectie en soortvorming bestudeerd worden.

    Nee, sorry. Het was Rene die het deed. Jij vroeg wel waarom ik dat niet zou willen. Daaruit merkte ik op dat jij impliciet de bewijslast wilde leggen bij de geologie. Excuus.
    Je zegt: ‘Macroevolutie volgt wat mij betreft uit moleculaire overeenkomst.’
    Ik probeer er de hele tijd al achter te komen hoe het kan dat je dit zo stellig beweert. Ik doe een poging je te begrijpen:

    In alle overeenkomst die jij ziet, zie je een patroon. Dat patroon zien we op kleine schaal letterlijk ontstaan en je vraagt je af waarom dan niet het hele patroon op die manier ontstaan is.

    Klopt mijn analyse tot zo ver? Zo ja, dan zal ik daar op reageren.

    @Vince: Waarom niet? Op een forum is het vanzelfsprekend dat je elkaar niet begrijpt of verkeerd interpreteert. Met elkaar communiceren zonder elkaar recht in de ogen te kijken is niet altijd makkelijk. Jij haalde uit de paper van Setterfield dat er meerdere methodes gebruikt zijn. Dat gebruikte je als argument tegen mijn stelling dat de data voor een afnemende lichtsnelheid met dezelfde methode en meetinstrumenten verkregen zijn. Dat gaat nog steeds op daar de data van al die 16 methodes afzonderlijk, een neerwaartse curve laten zien. Dit stond even verder in de paper.

  37. @Martin
    Ik heb altijd geleerd dat m de rustmassa is en ik zie dat mijn natuurkundeboeken dat ook doen: “…Einstein called mc^2 the rest energy…” (Giancoli).
    Maar goed, dat is eigenlijk maar een detail, het is maar net hoe je het allemaal definieert.
    Maar ik ben het met je eens, de lichtsnelheid is constant en daarmee is die discussie gesloten.

  38. Zo te lezen is die discussie nog niet gesloten:
    “Dat gaat nog steeds op daar de data van al die 16 methodes afzonderlijk, een neerwaartse curve laten zien. Dit stond even verder in de paper.”
    @albert
    Misschien is dit al eerder genoemd maar volgens talkorigins laat de data eerder zien dat de lichtsnelheid gestegen is… Alleen valt de stijging binnen de meetonzekerheid. (http://www.talkorigins.org/indexcc/CE/CE411.html)

    De fijnstructuur constante is o.a. afhankelijk van de lichtsnelheid en deze was een paar miljard jaar geleden gelijk aan de fijnstructuur constante van nu. (Dit bleek uit onderzoek van een natuurlijke kernreactor, Oklo, die een paar miljard jaar geleden actief was).

  39. @ GW: Talkorigins is geen goede raadgever.

    In 1973, an attempt was made by Goldstein et al to reanalyze 40 of Roemer’s original observations to come to some definite conclusions. What Goldstein and his team did was to adopt a model for the Jupiter-Io system and calculate the eclipse times for any given position of the earth. They chose the forty most reliable eclipse times from Roemer’s diary which were then compared with times from their model. They concluded that “The best fitting value for the light travel time across one astronomical unite [the radius of the earth’s orbit] does not differ from the currently accepted value by one part in 200.” Their final statement was that “the velocity of light did not differ by 0.5% in 1668 to 1678 from the current value.”21

    Does this negate the idea of any variation in c? No, it does not. An immediate problem with the analysis surfaces when we look at what was done in 1973. As Goldstein and his co-workers point out, their method results in what is known as a “root mean square” (rms) deviation of observed times compared with the model of 118 seconds. In other words, the predicted times from their model disagreed with Roemer’s observations by an average of almost two minutes! The claim that c did not differ by 0.5% about 1675 is therefore meaningless. An rms error of 118 seconds in about 1000 seconds for the observed delay across the diameter of the earth’s orbit is an 11.8% error, which is equivalent to ± 35,000 Km/s in the value of c. Any suggested variation in c is very liberally covered by this error margin!
    http://setterfield.org/000docs/cx1.html

    Tevens, als de lichtsnelheid afneemt, moet de constante van plank toenemen, want h=1/c. Dit is precies wat de data laten zien: http://www.setterfield.org/report/report.html#4c

    Weer een toevallige deviatie?

    Ten slotte: Setterfield bedenkt dit niet zelf, maar maakt enkel gebruik van wetenschappelijke papers.

  40. @albert januari 7th, 2010 on 7:40 pm
    Is de oorzaak van overeenkomst (verwantschap) die jij aandraagt een waarneembare? Het is afgeleid uit de theorie.
    Over het algemeen lijken kinderen en ouders op elkaar, en broers en zusters. Zelfs neven en nichten bij een familiereunie en op DNA niveau. Daarmee is verwantschap een waarneembare oorzaak van overeenkomst (en niets theoretisch). Dat is mijn enige bewering, er zit niets theorie-gestuurds in. Ik ga uit van de waarneming dat kinderen op hun ouders en broers en zusters lijken, en ga daarmee aan het werk.
    Er is in mijn opstelling niets met interpretatie en paradigma: alles komt uit de waarneming. Daarentegen is een Creator inderdaad zuiver een veronderstelde oorzaak van overeenkomst: geen enkele waarneming.
    Je eigen interpretatie is volledig a priori, en niet vanuit de waarneming. Alle evolutiebiologie begint vanuit de waarneming, en als er iets over afstamming komt, dan is dat een gevolgtrekking, en geen a priori.

    Ik had eigenlijk gehoopt op een sterker voorbeeld.
    Veranderingen zijn zelden groot.

    hoe zeker het is dat hier sprake is van een duplicatie.
    1 Er is spake van genetische variatie in aantal amylase genen binnen sommige populaties
    2 De genen liggen naast elkaar:
    http://flybase.org/reports/FBgn0000078.html
    3 Op flybase staan ook de nucleotide sequenties: 13 verschillen op 1485 nucleotides.
    Wat wou je dan wel een duplicatie noemen, als je dit niet overtuigend genoeg vindt?

    In alle overeenkomst die jij ziet, zie je een patroon. Dat patroon zien we op kleine schaal letterlijk ontstaan en je vraagt je af waarom dan niet het hele patroon op die manier ontstaan is.

    Kijk, daar heb je een punt te pakken: dat patroon zien we op kleine schaal letterlijk ontstaan. Als je dan niet het hele patroon op dezelfde manier wilt laten ontstaan, moet je grondig laten zien waarom dat niet kan.

    Ik schrijf zo af en toe over patronen op http://evolutiebiologie.blogspot.com/. Ik hoop morgen de gegevens over hemoglobine daarop te zetten.

  41. Albert schreef:
    @Vince: Jij haalde uit de paper van Setterfield dat er meerdere methodes gebruikt zijn. Dat gebruikte je als argument tegen mijn stelling dat de data voor een afnemende lichtsnelheid met dezelfde methode en meetinstrumenten verkregen zijn.

    Hehe, eindelijk heb je me goed begrepen. Daar was het me om te doen.

    @GW heb je wat meer info over Oklo ?

  42. @Albert “As Goldstein and his co-workers point out, their method results in what is known as a “root mean square” (rms) deviation of observed times compared with the model of 118 seconds. In other words, the predicted times from their model disagreed with Roemer’s observations by an average of almost two minutes!”

    Dit laat zien dat Setterfield echt niet spoort. RMS deviation is iets anders dan average deviation. RMS betekent Root-Mean-Square: dus eerst alle deltas kwadrateren, dan middelen en daar weer de wortel uit. Als er ruis is dan is de RMS van e ruis altijd >0.

    Als ik een elektrische weerstand R meet via een stroom vs. spanning grafiekje, en er is ruis, dan krijg ik een RMS afwijking >0 van de data met de theoretische rechte lijn V=IR, maar dat betekent niet dat R niet constant zou zijn. Daarom is in de wetenschap “least squares fitting” zeer populair: dat geeft je de maximum likelihood schatting van je parameters. Goldstein et al laten zien dat de beste schatter voor c dezelfe waarde oplevert als tegenwoordig.

    Data analyse is een serieuze bezigheid, laten we het daarop houden.

  43. Toevoeging: bij Goldstein et al is de RMS=118 seconden, maar de “average deviation”=0.

  44. En over h=1/c: Setterfield zegt dat overigens niet, hij zegt dat h evenredig is aan 1/c.

    Setterfield verzwijgt, dat zijn formules voor orbit energies alleen voor waterstof(achtige) atomen geldt: een kernlading +Ze en slechts 1 electron. De Rydberg formule geldt ook alleen voor 1-electron atomen.

    Het is onbegonnen werk om dat debiele gedoe van Setterfield helemaal door te werken. Ik kap ermee.

Geef een antwoord

Het e-mailadres wordt niet gepubliceerd.

Deze site gebruikt Akismet om spam te verminderen. Bekijk hoe je reactie-gegevens worden verwerkt.